PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g09110.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 536aa    MW: 58128.8 Da    PI: 4.992
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g09110.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.41.5e-41147224178
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     +CqvegCeadl+ ak+yhrrhkvCe+h+ka++++v +  qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Zjn_sc00014.1.g09110.1.am.mkhc 147 ACQVEGCEADLTAAKDYHRRHKVCEMHAKASTAVVGNAVQRFCQQCSRFHLLEEFDEGKRSCRRRLAGHNRRRRKTRP 224
                                     5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-34140209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.624145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-39146226IPR004333Transcription factor, SBP-box
PfamPF031101.5E-30148221IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MEAAGFGAQS SHLYGVGLSE LDLNRRDKRV FGWDLNEWSW DSERFIATPV PASVPNGLEL  60
NSSPSSSEEA EAEVARNDAV RGDPEKRKRV VVIDDDEAEH QDCGGALSLK IGGDAGGPRT  120
VESGNVNEEE RNGKKIKVQG GSSSGPACQV EGCEADLTAA KDYHRRHKVC EMHAKASTAV  180
VGNAVQRFCQ QCSRFHLLEE FDEGKRSCRR RLAGHNRRRR KTRPDISLGG AASIEDKLTI  240
FPYRTEARAC KVKDFDLNDT CNDMEGFENG HEVPPTPAFT AAGSPNCPSW MQQDSTQSPP  300
QTSGNSDSTS TQSLASSNGD AQDVCSEVSE LESIFESSRH ELADVDDVAR NQALEPDALG  360
PSTITPLHIA ASTSDAEDVL DALTDDPGLV GISAWKNARD DTGFTPEDYA RQRGNDAYLN  420
LVQKKIDKNT SGAHVVLGVP SSICPVGADD MKLGDVSLEI CSSMPMAAPM AKCHLCSHQA  480
RMYSRSSVRT FLYRPAMLMM MGVAVVCVCV GILLHTMPKV YAAPTFRWEL LERGAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31141221484squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466159.11e-113hypothetical protein SORBIDRAFT_01g002530
SwissprotQ75LH61e-104SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLC5WU181e-113C5WU18_SORBI; Putative uncharacterized protein Sb01g002530
STRINGSb01g002530.11e-112(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.14e-37squamosa promoter-binding protein-like 12